• Species Reactivity

  Human

• Specificity

  Detects human Neuropeptide Y/NPY in direct ELISAs.

• Source

  Monoclonal Mouse IgG    _2A Clone # 904032

• Purification

  Protein A or G purified from hybridoma culture supernatant

• Immunogen

  Neuropeptide Y/NPY conjugated to KLH    
  YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY    
  Accession # P01303

• Formulation

  Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 µm filtered solution in PBS.

• Label

  Unconjugated

Applications

• 
  

  Recommended    
  Concentration

  Sample

• Immunohistochemistry

  8-25 µg/mL

  See below

• 
  

Please Note: Optimal dilutions should be determined by each laboratory for each application.  are available in the Technical Information section on our website.

Data Examples

Preparation and Storage

• Reconstitution

  Reconstitute at 0.5 mg/mL in sterile PBS.

• Shipping

  The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below. *Small pack size (SP) is shipped with polar packs. Upon receipt, store it immediately at -20 to -70 °C

• Stability & Storage

  Use a manual defrost freezer and avoid repeated freeze-thaw cycles.    

• 12 months from date of receipt, -20 to -70 °C as supplied.

• 1 month, 2 to 8 °C under sterile conditions after reconstitution.

• 6 months, -20 to -70 °C under sterile conditions after reconstitution.

Background: Neuropeptide Y/NPY

Neuropeptide Y (NPY) is a 36 amino acid peptide that was isolated from hypothalamus in porcine brain in 1982 and lately it belongs to a family of peptides which include Pancreatic Polypeptide (PP) and Peptide YY (PYY) which exert their pharmacological action via interaction with  G-protein coupled receptors Y1, Y2, Y4, Y5 and y6. NPY is the most abundant peptide in brain and in nervous system NPY functions as a neurotransmitter regulating many processes including memory and learning, pain, fat storage and blood pressure. NPY also regulates stress by stimulating secretion of corticotropin-releasing hormone in brain. It appears there is a correlation between the increased levels of NPY gene expression in hippocampus and epileptic seizures. Cocaine reduces the levels of NPY and such a decrease is thought to be related to depression and anxiety. NPY receptors are  rhodopsin-like G-protein coupled receptors (GPCR) coupled to G_i or G₀ proteins, which inhibit adenylate cyclase and reduce cAMP accumulation and modulate Calcium and Potassium channels.      

• Entrez Gene IDs:

  4852 (Human); 109648 (Mouse); 24604 (Rat); 397304 (Porcine)

• Alternate Names:

  170 kDa melanoma membrane-bound gelatinase; DKFZp686G13158; DPPIV; EC 3.4.21.-; FAPA; Fibroblast activation protein alpha; fibroblast activation protein, alpha; Integral membrane serine protease; Neuropeptide Y; NPY; PYY4; seprase