详细说明
Species Reactivity
Human
Specificity
Detects human Osteocalcin in direct ELISAs.
Source
Monoclonal Mouse IgG 1 Clone # 190125
Purification
Protein A or G purified from hybridoma culture supernatant
Immunogen
Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818Formulation
Supplied in a saline solution containing BSA and Sodium Azide.
Label
Allophycocyanin
Applications
Recommended
ConcentrationSample
Intracellular Staining by Flow Cytometry
10 µL/10 6 cells
See below
Please Note: Optimal dilutions should be determined by each laboratory for each application. are available in the Technical Information section on our website.
Data Examples
Intracellular Staining by Flow Cytometry | Detection of Osteocalcin in Saos‑2 Human Cell Line by Flow Cytometry. Saos‑2 human osteosarcoma cell line was stained with Mouse Anti-Human Osteocalcin APC‑conjugated Monoclonal Antibody (Catalog # IC1419A, filled histogram) or isotype control antibody (Catalog # , open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # ) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # ). View our protocol for . |
Intracellular Staining by Flow Cytometry | Detection of Osteocalcin in Human Osteoblasts by Flow Cytometry. Human osteoblasts were stained with Mouse Anti-Human Osteocalcin APC‑conjugated Monoclonal Antibody (Catalog # IC1419A, filled histogram) or isotype control antibody (Catalog # , open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # ) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # ). View our protocol for . |
Preparation and Storage
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Protect from light. Do not freeze.
12 months from date of receipt, 2 to 8 °C as supplied.
Background: Osteocalcin
Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.
References:
Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.
Long Name:
Bone gamma-Carboxyglutamate [gla] Protein
Entrez Gene IDs:
632 (Human); 12096 (Mouse); 25295 (Rat)
Alternate Names:
BGLAP; BGP; bone gamma-carboxyglutamate (gla) protein (osteocalcin); bone gamma-carboxyglutamate (gla) protein; Bone Gla protein; Gamma-carboxyglutamic acid-containing protein; OC; OCN; Osteocalcin













粤公网安备44196802000105号